If you have been reading about NMR spectroscopy and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-07-28. Numbers and descriptions here follow the published literature rather than marketing material.
Quality control for NMN materials typically includes identity, assay, purity, and impurity profiling. Tests may cover residual solvents, heavy metals, microbial limits, and water content, depending on the intended use and local rules. Impurity profiles can include related substances such as nicotinamide, nicotinamide riboside, and NAD+, which may form during synthesis or storage. Because commercial NMN can be offered as different salts or hydrate forms, a certificate of analysis should state the form and the analytical methods used. Independent verification is relevant because supplement markets vary in testing requirements and enforcement.
Laboratory identification of NMN usually relies on chromatographic separation coupled with ultraviolet or mass spectrometric detection. High-performance liquid chromatography with UV absorbance can quantify the compound against a reference standard, while liquid chromatography-tandem mass spectrometry offers lower detection limits and better specificity in complex matrices. Nuclear magnetic resonance spectroscopy can confirm structural identity and isomeric form. Ion chromatography or capillary electrophoresis may be used to identify counterions such as sodium. Method validation includes accuracy, precision, linearity, and limits of detection.
Stability testing examines how temperature, humidity, light, and pH affect NMN over time. The compound is generally stored cold, often at minus twenty degrees Celsius or lower, in a desiccated container protected from light. Aqueous solutions tend to be less stable than dry powder because hydrolysis and dephosphorylation can occur, potentially forming nicotinamide riboside or other degradation products. Stress studies may expose samples to heat, acid, base, oxidation, and strong light to identify likely degradation pathways. Results from such studies help define shelf life and handling recommendations, though exact stability depends on formulation and packaging.
Analytical measurement of NMN typically uses high-performance liquid chromatography with ultraviolet detection, often at a wavelength near 260 nanometers. Liquid chromatography coupled with tandem mass spectrometry provides greater sensitivity and specificity, especially for biological samples. Nuclear magnetic resonance spectroscopy can confirm structure and detect certain impurities. Purity values reported by suppliers depend on the analytical method, calibration standards, and whether related compounds such as nicotinamide or NAD+ are included in the calculation. Independent verification is useful because supplement labels may not fully describe the tested material.
Regulatory treatment of NMN differs by country and has changed over time. In the United States, the Food and Drug Administration has stated that NMN is excluded from the definition of a dietary supplement because it was investigated as a drug before being marketed as a supplement; enforcement and legal interpretation continue to evolve. In the European Union, NMN may require authorization as a novel food before sale. In Japan, NMN has been marketed in some food products, while it is not approved as a therapeutic drug in major markets. These categories affect labeling, permitted claims, and quality oversight.
| Property | Value | Notes |
|---|---|---|
| Typical assay method | HPLC with UV detection | Often at 254 or 260 nm; LC-MS/MS used for trace analysis. |
| Storage temperature | -20 °C or below | Dry powder; protect from light and moisture. |
| Aqueous stability | Limited | Solutions may hydrolyze or dephosphorylate; prepare fresh when possible. |
| Counterion check | Ion chromatography | Identifies sodium or other counterions in salt forms. |
| Common related impurities | Nicotinamide, nicotinamide riboside, NAD+ | Monitored by chromatographic purity methods. |
Solid NMN is generally handled as a moisture-sensitive compound. Dry material stored desiccated at low temperature, protected from light, tends to remain stable for extended periods. Aqueous solutions are less stable and can undergo hydrolysis, especially at elevated temperature or alkaline pH. The anomeric form also matters: beta-NMN is the naturally occurring form, while alpha-NMN can appear as a synthetic impurity. Purity and storage conditions therefore influence both analytical results and experimental reproducibility.
Identity and purity are usually assessed with complementary methods. Nuclear magnetic resonance spectroscopy can confirm the molecular structure and distinguish anomeric forms. High-performance liquid chromatography with ultraviolet detection or mass spectrometry is common for assay and related-substance testing. Mass spectrometry also supports trace quantification in biological samples, often with isotope-labeled internal standards. Because NMN lacks a strong chromophore, some ultraviolet methods require careful wavelength selection or derivatization, and laboratories may validate each approach for its intended matrix.
Analytical measurement of NMN typically uses reversed-phase high-performance liquid chromatography with ultraviolet detection near 260 nm. Mass spectrometry, often coupled to liquid chromatography, provides sensitive quantification and confirmatory identification in biological matrices. Nuclear magnetic resonance spectroscopy is used to verify molecular structure and distinguish related nucleotides. Because NMN is polar and poorly retained on conventional reversed-phase columns, ion-pairing reagents or hydrophilic interaction chromatography are sometimes employed. Reported purity values depend on the chosen method, calibration standard, and whether related substances are resolved.
Stability studies indicate that NMN is sensitive to heat, light, and pH extremes. In aqueous solution, hydrolysis can cleave the phosphate linkage or convert NMN to related nicotinamide derivatives, with degradation accelerating at elevated temperatures and alkaline conditions. Solid material is generally more stable when kept dry and cold, and research-grade supplies are often stored at minus twenty degrees Celsius or lower, protected from light and moisture. Repeated freeze-thaw cycles of solutions can promote degradation, so aliquoting is a common laboratory practice. The exact shelf life depends on purity, counterion, packaging, and storage history.
Quality control for NMN focuses on identity, purity, and the absence of harmful contaminants. Certificates of analysis may report high-performance liquid chromatography purity, mass spectrometry identity, residual solvents, heavy metals, and microbial limits, depending on grade and intended use. Because NMN can exist as different isomers, salts, or hydrates, specification sheets should state the exact form being tested. There is no single globally harmonized purity standard for NMN products. Open questions include which degradation products are most relevant under real-world storage and how analytical results from different laboratories can be compared reliably.
1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC, EDAC or EDCI) is a water-soluble carbodiimide usually handled as the hydrochloride, which is a white solid. It is typically employed in the 4.0-6.0 pH range. It is generally used as a carboxyl activating agent for the coupling of primary amines to yield amide bonds. While other carbodiimides like dicyclohexylcarbodiimide (DCC) or diisopropylcarbodiimide (DIC) are also employed for this purpose, EDC has the advantage that the urea byproduct formed (often challenging to remove in the case of DCC or DIC) can be washed away from the amide product using dilute acid. Additionally, EDC can also be used to activate phosphate groups in order to form phosphomonoesters and phosphodiesters. Common uses for this carbodiimide include peptide synthesis, protein crosslinking to nucleic acids, but also in the preparation of immunoconjugates. EDC is often used in combination with N-hydroxysuccinimide (NHS) for the immobilisation of large biomolecules. Recent work has also used EDC to assess the structure state of uracil nucleobases in RNA.
National teams June 3 – 9: 2019 FIBA Under-16 Americas Championship in Belém The United States defeated Canada, 94–77, to win their sixth consecutive FIBA Under-16 Americas Championship title. The Dominican Republic took third place. Argentina took fourth place. Note: All teams mentioned above have qualified to compete at the 2020 FIBA Under-17 Basketball World Cup. June 16 – 22: 2019 FIBA Under-16 Women's Americas Championship in Puerto Aysén The United States defeated Canada, 87–37, to win their second consecutive and fifth overall FIBA Under-16 Women's Americas Championship title. Chile took third place. Puerto Rico took fourth place. Note: All teams mentioned above have qualified to compete at the 2020 FIBA Under-17 Women's Basketball World Cup. September 22 – 29: 2019 FIBA Women's AmeriCup in San Juan The United States defeated Canada, 67–46, to win their third FIBA Women's AmeriCup title. Brazil took third place. Note: The first eight teams have qualified to compete at the Americas 2020 Olympic pre-qualifying tournaments. Club teams January 18 – March 31: 2019 FIBA Americas League San Lorenzo defeated Guaros, 64–61, to win their second consecutive FIBA Americas League title.
The tournament will be hosted by whoever wins the regular season title. Right now, either James Madison or Old Dominion will host the tournament, depending on their regular season outcomes. Last updated: October 31, 2011Source: NMN Athletics Colonial Athletic Association 2011 CAA Men's Soccer Tournament 2011 NCAA Division I men's soccer season 2011 NCAA Division I Men's Soccer Championship
To meet the NADPH and ATP demands in the mesophyll and bundle sheath, light needs to be harvested and shared between two distinct electron transfer chains. ATP may be produced in the bundle sheath mainly through cyclic electron flow around Photosystem I, or in the mesophyll mainly through linear electron flow, depending on the light available in the bundle sheath or in the mesophyll. The relative requirement of ATP and NADPH in each type of cell will depend on the photosynthetic subtype. The apportioning of excitation energy between the two cell types will influence the availability of ATP and NADPH in the mesophyll and bundle sheath. For instance, green light is not strongly adsorbed by mesophyll cells and can preferentially excite bundle sheath cells, or vice versa for blue light. Because bundle sheaths are surrounded by mesophyll, light harvesting in the mesophyll will reduce the light available to reach bundle sheath cells. Also, the bundle sheath size limits the amount of light that can be harvested.
Sources: en.wikipedia.org
The right side of a positive-sensed AAV genome encodes overlapping sequences of three capsid proteins, VP1, VP2 and VP3, and two accessory proteins, MAAP & AAP, which start from one promoter, designated p40. The molecular weights of these proteins are 87, 72 and 62 kiloDaltons, respectively. The AAV capsid is composed of a mixture of VP1, VP2, and VP3 totaling 60 monomers arranged in icosahedral symmetry in a ratio of 1:1:10, with an empty mass of approximately 3.8 MDa. The crystal structure of the VP3 protein was determined by Xie, Bue, et al.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
NETA has antigonadotropic effects via its progestogenic activity and can dose-dependently suppress gonadotropin and sex hormone levels in women and men. The ovulation-inhibiting dose of NETA is about 0.5 mg/day in women. In healthy young men, NETA alone at a dose of 5 to 10 mg/day orally for 2 weeks suppressed testosterone levels from ~527 ng/dL to ~231 ng/dL (–56%). NETA, also known as norethinyltestosterone acetate, as well as 17α-ethynyl-19-nortestosterone 17β-acetate or 17α-ethynylestra-4-en-17β-ol-3-one 17β-acetate, is a progestin, or synthetic progestogen, of the 19-nortestosterone group, and a synthetic estrane steroid. It is the C17β acetate ester of norethisterone. NETA is a derivative of testosterone with an ethynyl group at the C17α position, the methyl group at the C19 position removed, and an acetate ester attached at the C17β position. In addition to testosterone, it is a combined derivative of nandrolone (19-nortestosterone) and ethisterone (17α-ethynyltestosterone). Chemical syntheses of NETA have been published.
Sources: en.wikipedia.org
The Swiss company GlycArt Biotechnology developed a system using CHO cells, where the cells were engineered to overexpress an enzyme called GnTIII. The effect of this overexpression is to block the formation of fucosylated oligosaccharides on the expressed antibodies. This technology was first reported in 1999 and was the basis of GlycArt Biotechnology. Roche acquired GlycArt in 2005 in order to acquire technology to afucosylate antibodies. GlycArt Biotechnology had been founded in 2000 as a spin-out company of the Swiss Federal Institute of Technology in Zurich. The first commercial product from the GlycArt acquisition was obinutuzumab, which as Gazyva gained FDA approval in November 2013 for the treatment of chronic lymphocytic leukemia. Kyowa Hakko Kirin's "Potelligent" platform uses a CHO cell line in which FUT8 has been knocked out, and which produces antibodies with little to no fucose in the Fc region. The company gained marketing approval in Japan in April 2012 for a monoclonal antibody drug called mogamulizumab which was developed using the platform. The Company's technology was first reported in 2004.
Gestational trophoblastic disease like hydatidiform moles ("molar pregnancy") or choriocarcinoma may produce high levels of βhCG due to the presence of syncytiotrophoblasts, part of the villi that make up the placenta, and despite the absence of an embryo. This, as well as several other conditions, can lead to elevated hCG readings in the absence of pregnancy. hCG levels are also a component of the triple test, a screening test for certain fetal chromosomal abnormalities/birth defects. High hCG levels in the maternal serum could suggest Down syndrome, potentially due to continued hCG production by the placenta beyond the first trimester. A study of 32 normal pregnancies came to the result that a gestational sac of 1–3 mm was detected at a mean hCG level of 1150 IU/L (range 800–1500), a yolk sac was detected at a mean level of 6000 IU/L (range 4500–7500) and fetal heartbeat was visible at a mean hCG level of 10,000 IU/L (range 8650–12,200).
The Public Affairs Office works with the PAAC to advocate for increased research budgets for the major governmental funding agencies, primarily the National Institutes of Health and the National Science Foundation. ASBMB has developed a set of recommendations for pre-medical course requirements consistent with the new Medical College Admission Test. Advocacy efforts also focus on protecting the conditions that promote a successful research environment. In addition, the office works to maintain a healthy relationship between ASBMB members, government officials, and the public in order to foster awareness of the importance of science to everyday life. As part of their advocacy efforts, ASBMB organizes Capitol Hill Day, an annual event that allows graduate students and trainees to meet their congressional representatives in Washington, D.C. List of biochemistry awards Official website American Society for Biochemistry and Molecular Biology records, 1906-2005 at the University of Maryland, Baltimore County
Sources: en.wikipedia.org
NMN is often measured by high-performance liquid chromatography with ultraviolet detection. Liquid chromatography-tandem mass spectrometry can provide greater sensitivity and specificity. The chosen method should be validated and compared against a certified reference standard when possible.
Cool temperatures slow chemical reactions that can degrade NMN over time. Moisture and light can also promote breakdown, so desiccated and light-protected containers are common. Storage recommendations may differ for dry powder and prepared solutions.
Related substances may include nicotinamide, nicotinamide riboside, and NAD+. Residual solvents or inorganic impurities can also be present depending on the manufacturing process. Purity testing aims to identify and limit these substances.
Solid NMN is commonly stored frozen at about minus 20 degrees Celsius, sealed against moisture, and protected from light. Solutions are typically prepared fresh because they can degrade more quickly. Specific storage conditions can vary by supplier and intended use.